PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009613649.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MYB
Protein Properties Length: 364aa    MW: 39638.7 Da    PI: 5.1873
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009613649.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.21.6e-175196147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     +g+W++eEd +l ++v  +G ++W++Iar ++ gR++k+c++rw + 
   XP_009613649.1 51 KGPWSPEEDAILSRLVSNFGARNWSLIARGIP-GRSGKSCRLRWCNQ 96
                     79******************************.***********985 PP

2Myb_DNA-binding55.81e-17103147147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      r++++ eEd ++++a++ +G++ W++Iar ++ gRt++ +k++w++ 
   XP_009613649.1 103 RKPFSDEEDRIILQAHAVHGNK-WASIARLLP-GRTDNAIKNHWNST 147
                      789*******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129420.3324697IPR017930Myb domain
SuperFamilySSF466892.05E-3048144IPR009057Homeodomain-like
SMARTSM007177.1E-155099IPR001005SANT/Myb domain
PfamPF002499.0E-175196IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.1E-2652104IPR009057Homeodomain-like
CDDcd001673.19E-145395No hitNo description
PROSITE profilePS5129427.32198152IPR017930Myb domain
SMARTSM007175.1E-17102150IPR001005SANT/Myb domain
PfamPF002492.0E-15103147IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.5E-24105151IPR009057Homeodomain-like
CDDcd001675.41E-13105148No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009751Biological Processresponse to salicylic acid
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 364 aa     Download sequence    Send to blast
MENNILENLE GCYGGGSGDA DGSVGGDDEE ALMLEDGSGS SDRKKTADRV KGPWSPEEDA  60
ILSRLVSNFG ARNWSLIARG IPGRSGKSCR LRWCNQLDPA VKRKPFSDEE DRIILQAHAV  120
HGNKWASIAR LLPGRTDNAI KNHWNSTLRR RCAELGKLRS DSSNVPEDVS AEKSKASSEE  180
TQSCGDVNSS RAIEGKDVSS HENQEDNHYD DKTREEIQRS DVANDPPTLF RPVARISAFS  240
VYGSMNVPET QLQTPRLTPI QAPDLGVSKL LEGAFTERLV PHQCGHGCFG NASQENNGSS  300
LLGPEFVDYA EPPLISSHEL ATLATEISNV AWCKSGLENS SIEVIFNPAT RGTRGTSHLP  360
SRPF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-40481514107B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00337DAPTransfer from AT3G09230Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754480.0HG975448.1 Solanum pennellii chromosome ch09, complete genome.
GenBankHG9755210.0HG975521.1 Solanum lycopersicum chromosome ch09, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009613649.10.0PREDICTED: myb-related protein B
RefseqXP_016450102.10.0PREDICTED: myb-related protein B-like
TrEMBLK4CRK40.0K4CRK4_SOLLC; Uncharacterized protein
STRINGSolyc09g011780.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA26112454
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G09230.13e-92myb domain protein 1